PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_7055g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 438aa    MW: 48314.3 Da    PI: 5.257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_7055g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd++l ++++ +G g W+  +++ g+ R++k+c++rw +yl
     MA_7055g0010 14 RGPWTLEEDLRLTNYIEAHGEGGWTNLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding46.96.5e-1573112748
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +E++l+++++++lG++ W++Ia +m+ gRt++++k++w+++l
     MA_7055g0010  73 DEEDLILRLHRLLGNR-WSLIAGRMP-GRTDNEIKNYWNTHL 112
                      7***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-20763IPR009057Homeodomain-like
PROSITE profilePS5129413.988961IPR017930Myb domain
SuperFamilySSF466897.65E-2811108IPR009057Homeodomain-like
SMARTSM007171.4E-111363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001673.35E-91661No hitNo description
PROSITE profilePS5129424.19162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2364116IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002492.3E-1373112IPR001005SANT/Myb domain
CDDcd001671.93E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MGRTPSSLNA GLNRGPWTLE EDLRLTNYIE AHGEGGWTNL PKKAGLLRCG KSCRLRWMNY  60
LRPDVKRGHI LLDEEDLILR LHRLLGNRWS LIAGRMPGRT DNEIKNYWNT HLSKKLLSQG  120
IDPRTHKPLS ESQNVTFSAP GDSETSQKSK QDKNTTIPGN IEESGADLQD EEEIAAQGNE  180
DQAAATWPGN NANNQLNPES SLICNPQPVS VPISMSPQAP VISSTAFQES TSTCVAEAVS  240
DSIVINHNKG SKQISFPLLN TACFNSSEQL AGVGRYDLDQ YLMNNPVTSS NDMITSTVRL  300
SSALQTAPFV GQFDSNQAFI SGNALLNEKH RMSLQNLQAL EMNPQPSFLV NPSEETIYNK  360
LSHTSCAVPD QIAAACSYSY PVIPTAMGTA LGDFNSDIFP SLLWEQLLEI LIQISSLPFW  420
DHLVMRSCSY KNPVQILQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-27811621128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1010000.0BT101000.1 Picea glauca clone GQ0063_D17 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LNN41e-143B8LNN4_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-56myb domain protein 6